Toggle light / dark theme

Controlling ultra-strong light-matter coupling at room temperature

Physicists at Chalmers University of Technology in Sweden, together with colleagues in Russia and Poland, have managed to achieve ultra-strong coupling between light and matter at room temperature. The discovery is of importance for fundamental research and might pave the way for advances in light sources, nanomachinery and quantum technology.

A set of two coupled oscillators is one of the most fundamental and widely used systems in physics. It is a very general toy model that describes a plethora of systems including guitar strings, acoustic resonators, the physics of children’s swings, molecules and chemical reactions, gravitationally bound systems, and quantum cavity electrodynamics.

The degree of coupling between the two oscillators is an important parameter that mostly determines the behavior of the coupled system. However, not much is known about the by which two pendula can couple to each other—and what consequences such coupling can have.

Carbon nanotubes developed for super efficient desalination

Membrane separations have become critical to human existence, with no better example than water purification. As water scarcity becomes more common and communities start running out of cheap available water, they need to supplement their supplies with desalinated water from seawater and brackish water sources.

Lawrence Livermore National Laboratory (LLNL) researchers have created (CNT) pores that are so efficient at removing salt from water that they are comparable to commercial desalination membranes. These tiny pores are just 0.8 nanometers (nm) in diameter. In comparison, a human hair is 60,000 nm across. The research appears on the cover of the Sept. 18 issue of the journal Science Advances.

The dominant technology for removing salt from water, , uses thin-film composite (TFC) membranes to separate water from the ions present in saline feed streams. However, some fundamental performance issues remain. For example, TFC membranes are constrained by the permeability-selectivity trade-offs and often have insufficient rejection of some ions and trace micropollutants, requiring additional purification stages that increase the energy and cost.

3 Ways Nanotechnology is Being Used to Battle Coronavirus

From diagnostics to treatments and vaccines, nanotechnology is being developed and deployed to help stop the spread of COVID-19.


The world-altering coronavirus behind the COVID-19 pandemic is thought to be just 60 nanometres to 120 nanometres in size. This is so mind bogglingly small that you could fit more than 400 of these virus particles into the width of a single hair on your head. In fact, coronaviruses are so small that we can’t see them with normal microscopes and require much fancier electron microscopes to study them. How can we battle a foe so minuscule that we cannot see it?

The views expressed in this article are those of the author alone and not the World Economic Forum.

Scientists Advance on One of Technology’s Holy Grails

CIEQSFTTLFACQTAAEIWRAFGYTVKIMVDNGNCRLHVC: these forty letters are a set of instructions for building a sophisticated medical device designed to recognize the flu virus in your body. The device latches onto the virus and deactivates the part of it that breaks into your cells. It is impossibly tiny—smaller than the virus on which it operates—and it can be manufactured, in tremendous quantities, by your own cells. It’s a protein.

Proteins—molecular machines capable of building, transforming, and interacting with other molecules—do most of the work of life. Antibodies, which defend our cells against invaders, are proteins. So are hormones, which deliver messages within us; enzymes, which carry out the chemical reactions we need to generate energy; and the myosin in our muscles, which contract when we move. A protein is a large molecule built from smaller molecules called amino acids. Our bodies use twenty amino acids to create proteins; our cells chain them together, following instructions in our DNA. (Each letter in a protein’s formula represents an amino acid: the first two in the flu-targeting protein above are cysteine and isoleucine.) After they’re assembled, these long chains crumple up into what often look like random globs. But the seeming chaos in their collapse is actually highly choreographed. Identical strings of amino acids almost always “fold” into identical three-dimensional shapes. This reliability allows each cell to create, on demand, its own suite of purpose-built biological tools. “Proteins are the most sophisticated molecules in the known universe,” Neil King, a biochemist at the University of Washington’s Institute for Protein Design (I.P.D.), told me. In their efficiency, refinement, and subtlety, they surpass pretty much anything that human beings can build.

Today, biochemists engineer proteins to fight infections, produce biofuels, and improve food stability. Usually, they tweak formulas that nature has already discovered, often by evolving new versions of naturally occurring proteins in their labs. But “de novo” protein design—design from scratch—has been “the holy grail of protein science for many decades,” Sarel Fleishman, a biochemist at the Weizmann Institute of Science, in Israel, told me. Designer proteins could help us cure diseases; build new kinds of materials and electronics; clean up the environment; create and transform life itself. In 2018, Frances Arnold, a chemical engineer at the California Institute of Technology, shared the Nobel Prize in Chemistry for her work on protein design. In April, when the coronavirus pandemic was peaking on the coasts, we spoke over video chat. Arnold, framed by palm trees, sat outside her home, in sunny Southern California. I asked how she thought about the potential of protein design. “Well, I think you just have to look at the world behind me, right?” she said. “Nature, for billions of years, has figured out how to extract resources from the environment—sunlight, carbon dioxide—and convert those into remarkable, living, functioning machines. That’s what we want to do—and do it sustainably, right? Do it in a way that life can go on.”

Light-based ‘tractor beam’ assembles materials at the nanoscale

Modern construction is a precision endeavor. Builders must use components manufactured to meet specific standards — such as beams of a desired composition or rivets of a specific size. The building industry relies on manufacturers to create these components reliably and reproducibly in order to construct secure bridges and sound skyscrapers.

Now imagine construction at a smaller scale — less than 1/100th the thickness of a piece of paper. This is the nanoscale. It is the scale at which scientists are working to develop potentially groundbreaking technologies in fields like quantum computing. It is also a scale where traditional fabrication methods simply will not work. Our standard tools, even miniaturized, are too bulky and too corrosive to reproducibly manufacture components at the nanoscale.

Researchers at the University of Washington have developed a method that could make reproducible manufacturing at the nanoscale possible. The team adapted a light-based technology employed widely in biology — known as optical traps or optical tweezers — to operate in a water-free liquid environment of carbon-rich organic solvents, thereby enabling new potential applications.

Boundaries no barrier for thermoelectricity

Though the Summer Olympics were postponed, there’s at least one place to see agile hurdlers go for the gold.

You just need a way to view these electron games.

Using a novel optical detection system, researchers at Rice University found that electricity generated by temperature differences doesn’t appear to be affected measurably by placed in its way in nanoscale gold wires, while strain and other defects in the material can change this “thermoelectric” response.

Growing gold nanoparticles inside tumors can help kill cancer

Gold isn’t just a pretty face – it’s shown promise in fighting cancer in many studies. Now researchers have found a way to grow gold nanoparticles directly inside cancer cells within 30 minutes, which can help with imaging and even be heated up to kill the tumors.


Gold isn’t just a pretty face – it’s shown promise in fighting cancer in many studies. Now researchers have found a way to grow gold nanoparticles directly inside cancer cells within 30 minutes, which can help with imaging and even be heated up to kill the tumors.

In previous work, gold nanostars, nanotubes and other nanoparticle structures have been sent into battle against cancer, but one of the main hurdles is getting the stuff inside the tumors. Sometimes they’re equipped with peptides that hunt down cancer, while others sneak in attached to white blood cells.

For this new study, researchers instead found a way to grow the gold directly inside the cancer cells. The advantage is that it doesn’t require as high a concentration of gold in the cell, and it can be done much quicker than other methods.

Making 3D objects disappear: Researchers create ultrathin invisibility cloak

Circa 2015


Invisibility cloaks are a staple of science fiction and fantasy, from Star Trek to Harry Potter, but don’t exist in real life, or do they? Scientists at the U.S. Department of Energy (DOE)’s Lawrence Berkeley National Laboratory (Berkeley Lab) and the University of California (UC) Berkeley have devised an ultra-thin invisibility “skin” cloak that can conform to the shape of an object and conceal it from detection with visible light. Although this cloak is only microscopic in size, the principles behind the technology should enable it to be scaled-up to conceal macroscopic items as well.

Working with brick-like blocks of gold nanoantennas, the Berkeley researchers fashioned a “skin cloak” barely 80 nanometers in thickness, that was wrapped around a three-dimensional object about the size of a few biological cells and arbitrarily shaped with multiple bumps and dents. The surface of the skin cloak was meta-engineered to reroute reflected waves so that the object was rendered invisible to optical detection when the cloak is activated.

“This is the first time a 3D object of arbitrary shape has been cloaked from ,” said Xiang Zhang, director of Berkeley Lab’s Materials Sciences Division and a world authority on metamaterials — artificial nanostructures engineered with electromagnetic properties not found in nature. “Our ultra-thin cloak now looks like a coat. It is easy to design and implement, and is potentially scalable for hiding macroscopic objects.”

Spin-Based Quantum Computing Breakthrough: Physicists Achieve Tunable Spin Wave Excitation

Physicists from MIPT and the Russian Quantum Center, joined by colleagues from Saratov State University and Michigan Technological University, have demonstrated new methods for controlling spin waves in nanostructured bismuth iron garnet films via short laser pulses. Presented in Nano Letters, the solution has potential for applications in energy-efficient information transfer and spin-based quantum computing.

A particle’s spin is its intrinsic angular momentum, which always has a direction. In magnetized materials, the spins all point in one direction. A local disruption of this magnetic order is accompanied by the propagation of spin waves, whose quanta are known as magnons.

Unlike the electrical current, spin wave propagation does not involve a transfer of matter. As a result, using magnons rather than electrons to transmit information leads to much smaller thermal losses. Data can be encoded in the phase or amplitude of a spin wave and processed via wave interference or nonlinear effects.

/* */