Toggle light / dark theme

SLAC invention could make particle accelerators 10 times smaller

Particle accelerators generate high-energy beams of electrons, protons and ions for a wide range of applications, including particle colliders that shed light on nature’s subatomic components, X-ray lasers that film atoms and molecules during chemical reactions and medical devices for treating cancer.

As a rule of thumb, the longer the accelerator, the more powerful it is. Now, a team led by scientists at the Department of Energy’s SLAC National Accelerator Laboratory has invented a new type of accelerator structure that delivers a 10 times larger energy gain over a given distance than conventional ones. This could make accelerators used for a given application 10 times shorter.

The key idea behind the technology, described in a recent article in Applied Physics Letters, is to use to boost particle energies.

Controlling ultra-strong light-matter coupling at room temperature

Physicists at Chalmers University of Technology in Sweden, together with colleagues in Russia and Poland, have managed to achieve ultra-strong coupling between light and matter at room temperature. The discovery is of importance for fundamental research and might pave the way for advances in light sources, nanomachinery and quantum technology.

A set of two coupled oscillators is one of the most fundamental and widely used systems in physics. It is a very general toy model that describes a plethora of systems including guitar strings, acoustic resonators, the physics of children’s swings, molecules and chemical reactions, gravitationally bound systems, and quantum cavity electrodynamics.

The degree of coupling between the two oscillators is an important parameter that mostly determines the behavior of the coupled system. However, not much is known about the by which two pendula can couple to each other—and what consequences such coupling can have.

A Quantum Molecular Assembler

Researchers have created a molecule in a single, precisely characterized quantum state by merging two carefully prepared atoms.

Researchers have demonstrated a quantum molecular assembler—a device that takes individual atoms as inputs and merges them into a molecule in a desired quantum state. The team used lasers to trap and cool one sodium (Na) atom and one cesium (Cs) atom, bring them together, and merge them into an NaCs molecule in a specific quantum state. Such a quantum-controlled molecule is a promising building block for quantum computers and could help researchers study the quantum details of chemical reactions.

Self-assembly of the plant cell wall requires an extensin scaffold

Circa 2008


Cytokinesis partitions the cell by a cleavage furrow in animals but by a new cross wall in plants. How this new wall assembles at the molecular level and connects with the mother cell wall remains unclear. A lethal Arabidopsis embryogenesis mutant designated root-, shoot-, hypocotyl-defective (rsh) provides some clues: RSH encodes extensin AtEXT3, a structural glycoprotein located in the nascent cross wall or “cell plate” and also in mature cell walls. Here we report that electron micrographs of rsh mutant cells lacking RSH extensin correspond to a wall phenotype typified by incomplete cross wall assembly. Biochemical characterization of the purified RSH glycoprotein isolated from wild-type Arabidopsis cell cultures confirmed its identity as AtEXT3: a (hydroxy)proline-rich glyco protein comprising 11 identical amphiphilic peptide repeats with a 28-residue periodicity: SOOOOKKHYVYKSOOOOVKHYSOOOVYH (O = Hyp), each repeat containing a hydrophobic isodityrosine cross-link motif (YVY, underlined). Atomic force microscopy of RSH glycoprotein imaged its propensity for self-assembly into a dendritic scaffold. Extensin peroxidase catalyzed in vitro formation of insoluble RSH gels with concomitant tyrosine cross-linking, hence this likelihood in muro. We conclude that self-assembling amphiphiles of lysine-rich RSH extensin form positively charged scaffolds in the cell plate. These react with negatively charged pectin to create an extensin pectate coacervate that may template further orderly deposition of the new cross wall at cytokinesis.

Conflict of interest statement

The authors declare no conflict of interest.

Physicists Break 150-Year-Old Rule for Phase Behavior – Something Many Considered Impossible

Eindhoven University of Technology researchers found five different phases in mixtures of two substances.

Frozen water can take on up to three forms at the same time when it melts: liquid, ice, and gas. This principle, which states that many substances can occur in up to three phases simultaneously, was explained 150 years ago by the Gibbs phase rule. Today, researchers from Eindhoven University of Technology and University Paris-Saclay are defying this classical theory, with proof of a five-phase equilibrium, something that many scholars considered impossible. This new knowledge yields useful insights for industries that work with complex mixtures, such as in the production of mayonnaise, paint, or LCD’s. The researchers have published their results in the journal Physical Review Letters.

The founder of contemporary thermodynamics and physical chemistry is the American physicist Josiah Willard Gibbs. In the 1870s he derived the phase rule, which describes the maximum number of different phases a substance or mixture of substances can assume simultaneously. For pure substances, the Gibbs Phase Rule predicts a maximum of 3 phases.

Scientists Advance on One of Technology’s Holy Grails

CIEQSFTTLFACQTAAEIWRAFGYTVKIMVDNGNCRLHVC: these forty letters are a set of instructions for building a sophisticated medical device designed to recognize the flu virus in your body. The device latches onto the virus and deactivates the part of it that breaks into your cells. It is impossibly tiny—smaller than the virus on which it operates—and it can be manufactured, in tremendous quantities, by your own cells. It’s a protein.

Proteins—molecular machines capable of building, transforming, and interacting with other molecules—do most of the work of life. Antibodies, which defend our cells against invaders, are proteins. So are hormones, which deliver messages within us; enzymes, which carry out the chemical reactions we need to generate energy; and the myosin in our muscles, which contract when we move. A protein is a large molecule built from smaller molecules called amino acids. Our bodies use twenty amino acids to create proteins; our cells chain them together, following instructions in our DNA. (Each letter in a protein’s formula represents an amino acid: the first two in the flu-targeting protein above are cysteine and isoleucine.) After they’re assembled, these long chains crumple up into what often look like random globs. But the seeming chaos in their collapse is actually highly choreographed. Identical strings of amino acids almost always “fold” into identical three-dimensional shapes. This reliability allows each cell to create, on demand, its own suite of purpose-built biological tools. “Proteins are the most sophisticated molecules in the known universe,” Neil King, a biochemist at the University of Washington’s Institute for Protein Design (I.P.D.), told me. In their efficiency, refinement, and subtlety, they surpass pretty much anything that human beings can build.

Today, biochemists engineer proteins to fight infections, produce biofuels, and improve food stability. Usually, they tweak formulas that nature has already discovered, often by evolving new versions of naturally occurring proteins in their labs. But “de novo” protein design—design from scratch—has been “the holy grail of protein science for many decades,” Sarel Fleishman, a biochemist at the Weizmann Institute of Science, in Israel, told me. Designer proteins could help us cure diseases; build new kinds of materials and electronics; clean up the environment; create and transform life itself. In 2018, Frances Arnold, a chemical engineer at the California Institute of Technology, shared the Nobel Prize in Chemistry for her work on protein design. In April, when the coronavirus pandemic was peaking on the coasts, we spoke over video chat. Arnold, framed by palm trees, sat outside her home, in sunny Southern California. I asked how she thought about the potential of protein design. “Well, I think you just have to look at the world behind me, right?” she said. “Nature, for billions of years, has figured out how to extract resources from the environment—sunlight, carbon dioxide—and convert those into remarkable, living, functioning machines. That’s what we want to do—and do it sustainably, right? Do it in a way that life can go on.”

Common drugs linked to increased risk of Alzheimer’s

A new study suggests anticholinergic medications may increase the risk of accelerated cognitive decline, especially in older adults at high risk of developing Alzheimer’s disease.

Anticholinergic drugs block the action of acetylcholine, a chemical messenger that controls a range of automatic bodily functions and plays a vital role in memory and attention.

Doctors prescribe these drugs for a variety of conditions, including urinary incontinence, overactive bladder, chronic obstructive pulmonary disorder (COPD), seasonal allergies, and depression.

Proofs of life on Venus can be obtained only through contact explorations

Discovering chemical substances as possible chemical markers of life existence in Venus’s atmosphere via remote astronomical observations cannot be considered objective evidence of life existence on the planet, says Roscosmos Executive Director for Science and Advanced Programs Alexander Bloshenko. ‘Credible scientific data on that matter can be obtained only via contact explorations of the planet’s surface and atmosphere,’ he added.

Notably, the USSR was the only country to conduct regular explorations of Venus using on-planet stations. The first ever soft landing on another planet’s surface in the Solar system was performed in 1970 by the Venera-7 descent module. Several orbital missions and landings provided detailed data on the Venerian climate, soil and atmosphere composition. The Soviet Venera-13 spacecraft still holds the record as the longest active spacecraft on Venus remaining operational for 127 minutes.

A huge breakaway of the Soviet Union from its competitors in exploration of Venus contributed to the fact that USA called Venus a ‘Soviet planet’. Having recently analyzed the pictures of Venus captured by Soviet missions, scientists of the Russian Academy of Sciences claimed they discovered moving objects and even might be living. And it remains to be seen, whether these guesses are true.

Today, a program of complex exploration of Venus has been developed by Roscosmos in cooperation with the Russian Academy of Sciences. The program consists of several missions. Moreover, a decision was taken to implement the previously planned Venera-D mission including orbital and landing modules, as a national project without involving wide international cooperation. The complex explorations will also include soil and atmosphere samples, as well as exploring evolution processes on Venus that has purportedly suffered a climatic disaster connected with greenhouse effect that is much discussed on Earth today.

Carl Sagan predicted life on Venus in 1967. We may be close to proving him right

Millions of space nerds reacted with joy Monday to a study showing the atmosphere of Venus contains phosphine, a chemical byproduct of biological life. But none would have been more thrilled or less surprised by the discovery than the late, great Carl Sagan — who said this day might come more than 50 years ago.

Now best remembered as the presenter of the most-viewed-ever PBS series Cosmos, the author of the book behind the movie Contact, and the guy who put gold disks of Earth music on NASA’s Voyager missions, Sagan actually got his start studying our closest two planets. He became an astronomer after being inspired as a kid by Edgar Rice Burroughs’ space fantasies, set on Mars and Venus.


‘Cosmos’ presenter Carl Sagan was one of the world’s top experts on Venus, and he saw first what scientists have just announced: possible life on Venus.

Colliding Neutron Stars Generate Just Small Amounts of Gold, Creating an Astronomical Mystery

Colliding neutron stars were touted as the main source of some of the heaviest elements in the Periodic Table. Now, not so much …

Neutron star collisions do not create the quantity of chemical elements previously assumed, a new analysis of galaxy evolution finds.

The research also reveals that current models can’t explain the amount of gold in the cosmos — creating an astronomical mystery.

/* */